missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Endophilin A1/SH3GL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | Endophilin A1/SH3GL2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18607925
|
Novus Biologicals
NBP2-38996-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18198287
|
Novus Biologicals
NBP2-38996 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Endophilin A1/SH3GL2 Polyclonal specifically detects Endophilin A1/SH3GL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Endophilin A1/SH3GL2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q99962 | |
| 6456 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CNSA2FLJ25015, EEN-B1bA335L15.1 (SH3-domain GRB2-like 2), Endophilin-1, endophilin-A1, FLJ20276, SH3 domain protein 2A, SH3 domain-containing GRB2-like protein 2, SH3D2AEndophilin A1 BAR domain, SH3-domain GRB2-like 2, SH3P4endophilin-1 | |
| SH3GL2 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title