missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ENDOGL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | ENDOGL1 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18348495
|
Novus Biologicals
NBP3-17706-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18378235
|
Novus Biologicals
NBP3-17706-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ENDOGL1 Polyclonal antibody specifically detects ENDOGL1 in Human samples. It is validated for ImmunofluorescenceSpecifications
| ENDOGL1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Endocrinology | |
| PBS, pH 7.2, 40% glycerol | |
| 9941 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 3.1.30, EC 3.1.30.-, Endo G-like 1, endo/exonuclease (5'-3'), endonuclease G-like, ENDOGL1mitochondrial, ENDOGL2, Endonuclease G-like 1MGC125945, ENGLA, ENGLB, ENGLMGC125944 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: AALQFFRSQGAEGALTGKQPDGSAEKAVLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title