ENDOGL1 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33188-100ul

Product Code. 30230467

Description

ENDOGL1 Monoclonal antibody specifically detects ENDOGL1 in Human samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: ENDOGL1
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: EC 3.1.30, EC 3.1.30.-, Endo G-like 1, endo/exonuclease (5'-3'), endonuclease G-like, ENDOGL1mitochondrial, ENDOGL2, Endonuclease G-like 1MGC125945, ENGLA, ENGLB, ENGLMGC125944
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 269-368 of human ENDOGL1 (Q9Y2C4).,, Sequence:, LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS
• Quantity: 100 μL
• Research Discipline: Endocrinology
• Gene ID (Entrez): 9941
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified