missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
EMR1 Polyclonal antibody specifically detects EMR1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
Specifications
| Antigen | EMR1 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:100 - 1:500, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | ADGRE1, egf-like module containing, mucin-like, hormone receptor-like 1, egf-like module containing, mucin-like, hormone receptor-like sequence 1, EGF-like module receptor 1, EGF-like module-containing mucin-like hormone receptor-like 1, EMR1 hormone receptor, TM7LN3 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 477-596 of human EMR1 (NP_001965.3).,, Sequence:, GVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGEL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?