missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EMR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35252-20ul
This item is not returnable.
View return policy
Description
EMR1 Polyclonal antibody specifically detects EMR1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| EMR1 | |
| Polyclonal | |
| Western Blot 1:100 - 1:500, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| ADGRE1, egf-like module containing, mucin-like, hormone receptor-like 1, egf-like module containing, mucin-like, hormone receptor-like sequence 1, EGF-like module receptor 1, EGF-like module-containing mucin-like hormone receptor-like 1, EMR1 hormone receptor, TM7LN3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 477-596 of human EMR1 (NP_001965.3).,, Sequence:, GVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGEL | |
| 20 μL | |
| Adaptive Immunity, GPCR, Immune System Diseases, Immunology, Innate Immunity, Myeloid derived Suppressor Cell | |
| 2015 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction