EMR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-13960-25ul

Product Code. 18444632

Description

EMR1 Polyclonal specifically detects EMR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EMR1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: ADGRE1, egf-like module containing, mucin-like, hormone receptor-like 1, egf-like module containing, mucin-like, hormone receptor-like sequence 1, EGF-like module receptor 1, EGF-like module-containing mucin-like hormone receptor-like 1, EMR1 hormone receptor, TM7LN3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ADGRE1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMAN
• Quantity: 25ul
• Research Discipline: Adaptive Immunity, GPCR, Immunology, Innate Immunity
• Gene ID (Entrez): 2015
• Target Species: Human
• Isotype: IgG

For Research Use Only