missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
EMP/MAEA Polyclonal specifically detects EMP/MAEA in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | EMP/MAEA |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | EMLP, EMPCell proliferation-inducing gene 5 protein, Erythroblast macrophage protein, HLC-10, Human lung cancer oncogene 10 protein, lung cancer-related protein 10, macrophage erythroblast attacher, PIG5, proliferation-inducing gene 5 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human EMP/MAEA. Peptide sequence KAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?