missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EML1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | EML1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
EML1 Polyclonal specifically detects EML1 in Human samples. It is validated for Western Blot.Specifications
| EML1 | |
| Polyclonal | |
| Rabbit | |
| O00423 | |
| 2009 | |
| Synthetic peptides corresponding to EML1(echinoderm microtubule associated protein like 1) The peptide sequence was selected from the C terminal of EML1. Peptide sequence YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| echinoderm microtubule associated protein like 1, ELP79, EMAP1, EMAP-1, EMAPechinoderm microtubule-associated protein-like 1, EMAPL1, EMAPLhuEMAP-1, FLJ45033, HuEMAP, HuEMAP-1 | |
| EML1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title