Invitrogen™ Emerin Monoclonal Antibody (5A10)

Mouse Monoclonal Antibody

Brand:  Invitrogen™ MA527874

Product Code. 15917144

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human placenta tissue, human Caco-2 whole cell, human HepG2 whole cell, Rabbit IgG, Marker 1113, human Jurkat whole cellhuman MDA-MB-453 whole cell, human SK-OV-3 whole cell, human SW620 whole cell. IHC: human gastric cancer tissue, human rectal cancer tissue. Flow: A431 cell.

Xeroderma pigmentosum type G (XPG) is a human genetic disease exhibiting extreme sensitivity to sunlight. The XPG protein, a member of the flap endonuclease 1 (FEN-1) structure-specific DNA repair endonuclease family, is an enzyme essential for DNA repair of the major kinds of solar ultraviolet (UV)-induced DNA damages. Human XPG nuclease makes the 3' incision during nucleotide excision repair of DNA. The enzyme cleaves model DNA bubble structures specifically near the junction of unpaired DNA with a duplex region. A 29-amino acid region of human XPG (residues 981-1009) contains the PCNA binding activity. A conserved arginine in XPG (Arg992) is crucial for its PCNA binding activity. Replication Protein A (RPA) binds specifically and directly to two excision repair proteins, the xeroderma pigmentosum damage-recognition protein XPA and the endonuclease XPG.

Specifications

• Antigen: Emerin
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P50402
• Gene Symbols: Emd
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Clone: 5A10
• Conjugate: Unconjugated
• Gene: Emd
• Gene Alias: AW550900; EDMD; EMD; Emerin; LEM domain containing 5; LEMD5; STA
• Host Species: Mouse
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2010
• Content And Storage: -20°C
• Form: Lyophilized