missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EMC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Applications | Western Blot |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
EMC2 Polyclonal specifically detects EMC2 in Human samples. It is validated for Western Blot.Specifications
| Western Blot | |
| Unconjugated | |
| RUO | |
| 9694 | |
| Synthetic peptides corresponding to TTC35(tetratricopeptide repeat domain 35) The peptide sequence was selected from the middle region of TTC35. Peptide sequence IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQE. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Q15006 | |
| EMC2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title