missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Elongin A Antibody, Novus Biologicals™

Elongin A Antibody, Novus Biologicals™

Product Code. 18425101 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18425101 25 μL 25µL
18482291 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18425101 Supplier Novus Biologicals Supplier No. NBP18704025ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Elongin A Polyclonal antibody specifically detects Elongin A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Elongin A
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias EloA, Elongin 110 kDa subunit, elongin-A, FLJ38760, FLJ42849, RNA polymerase II transcription factor SIII subunit A1, SIII, SIII p110, TCEB3A, transcription elongation factor B (SIII), polypeptide 3 (110kD, elongin A), transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A), transcription elongation factor B alpha subunit, transcription elongation factor B polypeptide 3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: ERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDKSKQGLDSFDTGKGAGD
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 6924
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.