missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELMOD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ELMOD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ELMOD2 Polyclonal specifically detects ELMOD2 in Human samples. It is validated for Western Blot.Specifications
| ELMOD2 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| ELMO domain containing 2, ELMO domain-containing protein 2,9830169G11Rik, ELMO/CED-12 domain containing 2, FLJ35768, FLJ38038, MGC10084 | |
| ELMOD2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IZ81 | |
| 255520 | |
| Synthetic peptides corresponding to ELMOD2(ELMO/CED-12 domain containing 2) The peptide sequence was selected from the N terminal of ELMOD2. Peptide sequence FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title