missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ELMOD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

ELMOD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Artikelnummer. 18314606
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μg
25 μg
missing translation for 'unitSize'
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18314606 25 μg 25µL
18363182 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18314606 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP31724625UL

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

ELMOD1 Polyclonal antibody specifically detects ELMOD1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ELMOD1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias DKFZp547C176, ELMO domain containing 1, ELMO domain-containing protein 1, ELMO/CED-12 domain containing 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCSKFSKAEWEKKRMDK
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 55531
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.