missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELMOD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ELMOD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Beskrivning
ELMOD1 Polyclonal specifically detects ELMOD1 in Human samples. It is validated for Western Blot.Specifikationer
| ELMOD1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| DKFZp547C176, ELMO domain containing 1, ELMO domain-containing protein 1, ELMO/CED-12 domain containing 1 | |
| ELMOD1 | |
| IgG | |
| 36 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001123509 | |
| 55531 | |
| Synthetic peptide directed towards the middle region of human ELMOD1The immunogen for this antibody is ELMOD1. Peptide sequence CYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKI. | |
| Primary |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel