ELMO3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-85695

Product Code. 18258056

Description

ELMO3 Polyclonal specifically detects ELMO3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ELMO3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CED12, CED-12, ced-12 homolog 3, ELMO-3, engulfment and cell motility 3, engulfment and cell motility 3 (ced-12 homolog, C. elegans), engulfment and cell motility protein 3, FLJ13824
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ELMO3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LVKSEVPLDRLLVHLQVMNQQLQTKAMALLTALLQGASPVERKHMLDYLWQRNLRQFIYKNIIHSAAPMGDEMAHHLYVLQALMLGL
• Quantity: 0.1 mL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 79767
• Target Species: Human
• Isotype: IgG

For Research Use Only