missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELMO2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35389-20ul
This item is not returnable.
View return policy
Description
ELMO2 Polyclonal antibody specifically detects ELMO2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| ELMO2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| ced-12 homolog 2, CED12A, ELMO-2, engulfment and cell motility 2, engulfment and cell motility 2 (ced-12 homolog, C. elegans), engulfment and cell motility protein 2, FLJ11656, hCed-12A, KIAA1834CED12CED-12, PH domain protein CED12A, Protein ced-12 homolog A | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 42-120 of human ELMO2 (NP_877496.1).,, Sequence:, SLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEF | |
| 20 μL | |
| Apoptosis | |
| 63916 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction