missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ELK4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ELK4 Polyclonal specifically detects ELK4 in Human samples. It is validated for Western Blot.Specifications
| ELK4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 2005 | |
| Synthetic peptides corresponding to ELK4 (ELK4, ETS-domain protein (SRF accessory protein 1)) The peptide sequence was selected from the C terminal of ELK4. Peptide sequence ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ELK4, ETS-domain protein (SRF accessory protein 1), ETS-domain protein, SAP-1, SAP1ETS domain-containing protein Elk-4, Serum response factor accessory protein 1, SRF accessory protein 1 | |
| ELK4 | |
| IgG | |
| 45 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title