missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Elf4/MEF Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£369.00
Specifications
| Antigen | Elf4/MEF |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Elf4/MEF Polyclonal specifically detects Elf4/MEF in Mouse samples. It is validated for Western Blot.Specifications
| Elf4/MEF | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS buffer, 2% sucrose | |
| 2000 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| E74-like factor 4, E74-like factor 4 (ets domain transcription factor), ETS-related transcription factor Elf-4, MEFELFRMyeloid Elf-1-like factor | |
| The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_062654). Peptide sequence DDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVT | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title