missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Elf4/MEF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£285.00 - £418.00
Specifications
| Antigen | Elf4/MEF |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18402392
|
Novus Biologicals
NBP2-33286-25ul |
25 μL |
£285.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18103923
|
Novus Biologicals
NBP2-33286 |
0.1 mL |
£418.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Elf4/MEF Polyclonal specifically detects Elf4/MEF in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Elf4/MEF | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q99607 | |
| 2000 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| E74-like factor 4, E74-like factor 4 (ets domain transcription factor), ETS-related transcription factor Elf-4, MEFELFRMyeloid Elf-1-like factor | |
| ELF4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title