missing translation for 'onlineSavingsMsg'
Learn More

ELAVL4 Antibody (6B9), Novus Biologicals™

Product Code. 18328207 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18328207 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18328207 Supplier Novus Biologicals Supplier No. H00001996M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

ELAVL4 Monoclonal antibody specifically detects ELAVL4 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), ELISA, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen ELAVL4
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA, KnockDown
Classification Monoclonal
Clone 6B9
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin 1:10-1:500, Sandwich ELISA 1:100-1:2000, Knockdown Validated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_068771
Gene Alias abnormal vision, Drosophila, homolog of, like-4, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), HuD, Paraneoplastic encephalomyelitis antigen HuD
Host Species Mouse
Immunogen ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience, Vision
Primary or Secondary Primary
Gene ID (Entrez) 1996
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.