missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELAVL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | ELAVL2 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18627935
|
Novus Biologicals
NBP2-38012-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18165209
|
Novus Biologicals
NBP2-38012 |
0.1 mL |
£488.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ELAVL2 Polyclonal specifically detects ELAVL2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ELAVL2 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience, Vision | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1993 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen B), ELAV-like neuronal protein 1, ELAV-like protein 2, HELN1, HEL-N1, Hu-antigen B, HuB, HUBELAV (embryonic lethal, abnormal vision, Drosophila)-like 2, Nervous system-specific RNA-binding protein Hel-N1 | |
| ELAVL2 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title