missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ELA2A Polyclonal specifically detects ELA2A in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | ELA2A |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | chymotrypsin-like elastase family member 2A, chymotrypsin-like elastase family, member 2A, EC 3.4.21, EC 3.4.21.71, ELA2Apancreatic elastase 2, elastase 2A, Elastase-2A, pancreatic elastase IIA, PE-1 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human ELA2A (NP_254275.1). Peptide sequence TGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSAWWGSSVKTSMICAGGDG |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?