missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EIF4E2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

EIF4E2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18387244
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18387244 25 μg 25µL
18394362 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18387244 Supplier Novus Biologicals Supplier No. NBP31783925UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

EIF4E2 Polyclonal antibody specifically detects EIF4E2 in Human samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen EIF4E2
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias 4EHP, 4E-LP, eIF4E type 2, eIF-4E type 2, EIF4EL3, eIF4E-like cap-binding protein, eIF4E-like protein 4E-LP, eukaryotic translation initiation factor 4E family member 2, Eukaryotic translation initiation factor 4E homologous protein, eukaryotic translation initiation factor 4E member 2, eukaryotic translation initiation factor 4E type 2, Eukaryotic translation initiation factor 4E-like 34E-LP, IF4e, mRNA cap-binding protein 4EHP, mRNA cap-binding protein type 3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline DNA Repair, DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 9470
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.