eIF4E Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57098

Product Code. 18285052

Description

eIF4E Polyclonal specifically detects eIF4E in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: eIF4E
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CBP, eIF4E, eIF-4E, EIF4E1, EIF4EL1MGC111573, EIF4F, eIF-4F 25 kDa subunit, eukaryotic translation initiation factor 4E, eukaryotic translation initiation factor 4E-like 1, mRNA cap-binding protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: EIF4E
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP
• Quantity: 100 μL
• Research Discipline: Cancer, DNA Repair, DNA replication Transcription Translation and Splicing, mTOR Pathway
• Gene ID (Entrez): 1977
• Target Species: Human
• Isotype: IgG

For Research Use Only