EIF3A, Mouse anti-Human, Clone: 2G4, Abnova™

Mouse Monoclonal Antibody

Marca:  Abnova H00008661-M02.100ug

Código de producto. 16168985

Descripción

Sequence: MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK

Especificaciones

• Antigen: EIF3A
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: eukaryotic translation initiation factor 3, subunit A
• Gene Alias: EIF3/EIF3S10/KIAA0139/P167/TIF32/eIF3-p170/eIF3-theta/p180/p185
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2G4
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_003750
• Gene Symbols: EIF3A
• Immunogen: EIF3A (NP_003741, 1 a.a. ∼ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 8661
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ