missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EIF3A Antibody (2G4), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00008661-M02
This item is not returnable.
View return policy
Description
EIF3A Monoclonal antibody specifically detects EIF3A in Human samples. It is validated for Western Blot, ELISA
Specifications
| EIF3A | |
| Monoclonal | |
| Unconjugated | |
| NP_003741 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA | |
| 2G4 | |
| In 1x PBS, pH 7.4 | |
| centrosomin homolog, cytoplasmic protein p167, eIF3 p167, eIF3 p180, eIF3 p185, EIF3, p180 subunit, eIF3a, eIF3-p170, EIF3S10EIF3, eIF-3-theta, eIF3-theta, Eukaryotic translation initiation factor 3 subunit 10, eukaryotic translation initiation factor 3 subunit A, eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170kD), eukaryotic translation initiation factor 3, subunit 10 (theta, 170kD), eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa, eukaryotic translation initiation factor 3, subunit 10, 170kD, eukaryotic translation initiation factor 3, subunit A, KIAA0139P167, p180, p185, TIF32 | |
| EIF3A (NP_003741, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK | |
| 0.1 mg | |
| Core ESC Like Genes, mTOR Pathway, Stem Cell Markers | |
| 8661 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction