missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18332629

EIF3A Antibody (2G4), Novus Biologicals™

Product Code. 18332629 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18332629 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18332629 Supplier Novus Biologicals Supplier No. H00008661M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

EIF3A Monoclonal antibody specifically detects EIF3A in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen EIF3A
Applications Western Blot, ELISA
Classification Monoclonal
Clone 2G4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003741
Gene Alias centrosomin homolog, cytoplasmic protein p167, eIF3 p167, eIF3 p180, eIF3 p185, EIF3, p180 subunit, eIF3a, eIF3-p170, EIF3S10EIF3, eIF-3-theta, eIF3-theta, Eukaryotic translation initiation factor 3 subunit 10, eukaryotic translation initiation factor 3 subunit A, eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170kD), eukaryotic translation initiation factor 3, subunit 10 (theta, 170kD), eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa, eukaryotic translation initiation factor 3, subunit 10, 170kD, eukaryotic translation initiation factor 3, subunit A, KIAA0139P167, p180, p185, TIF32
Host Species Mouse
Immunogen EIF3A (NP_003741, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Core ESC Like Genes, mTOR Pathway, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 8661
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.