missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EHD4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | EHD4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
EHD4 Polyclonal specifically detects EHD4 in Human samples. It is validated for Western Blot.Specifications
| EHD4 | |
| Polyclonal | |
| Rabbit | |
| Q9H223 | |
| 30844 | |
| Synthetic peptides corresponding to EHD4(EH-domain containing 4) The peptide sequence was selected from the middle region of EHD4. Peptide sequence KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EH domain containing 4, EH domain-containing protein 4, EH-domain containing 4, HCA10, HCA11, Hepatocellular carcinoma-associated protein 10/11, hepatocellular carcinoma-associated protein HCA11, ortholog of rat pincher, PAST homolog 4, PAST4 | |
| EHD4 | |
| IgG | |
| 61 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title