missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Eg5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58929
This item is not returnable.
View return policy
Description
Eg5 Polyclonal specifically detects Eg5 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| Eg5 | |
| Polyclonal | |
| Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| Eg5, HKSP, kinesin family member 11, kinesin-like 1, Kinesin-like protein 1, kinesin-like protein KIF11, Kinesin-like spindle protein HKSP, Kinesin-related motor protein Eg5, KNSL1TRIP-5, thyroid receptor interacting protein 5, Thyroid receptor-interacting protein 5, TR-interacting protein 5, TRIP5EG5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| KIF11 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIVELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVK | |
| 100 μL | |
| Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, Cytoskeleton Markers, Signal Transduction, Stem Cell Markers | |
| 3832 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction