missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
EFCAB13 Polyclonal specifically detects EFCAB13 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | EFCAB13 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | C17orf57, chromosome 17 open reading frame 57, EF-hand domain-containing protein C17orf57, FLJ36110, FLJ40342, FLJ58126 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human EFCAB13. Peptide sequence RKFLGGVGSSNVGVQEPYSKNGINFKKHSEKGEIHDSKSKPQSLKSSTSL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?