EEF1E1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92227-0.02ml

Product Code. 18616841

Description

EEF1E1 Polyclonal antibody specifically detects EEF1E1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: EEF1E1
• Classification: Polyclonal
• Dilution: Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200
• Gene Alias: AIMP3Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3, ARS-interacting multifunctional protein 3, Elongation factor p18, eukaryotic translation elongation factor 1 epsilon 1, eukaryotic translation elongation factor 1 epsilon-1, Multisynthase complex auxiliary component p18, P18, p18 component of aminoacyl-tRNA synthetase complex
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EEF1E1 (NP_004271.1). MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNS
• Quantity: 0.02 mL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 9521
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified