missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
eEF1A2 binding protein Monoclonal antibody specifically detects eEF1A2 binding protein in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA
Specifications
Specifications
| Antigen | eEF1A2 binding protein |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 5B12 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Alias | DKFZp434B1231, eEF1A2 binding protein, EEF1A2-binding protein 1, EEF1A2BP1, immunoglobulin-like and fibronectin type III domain containing 1, immunoglobulin-like and fibronectin type III domain-containing protein 1, KY-interacting protein 1, KYIP1 |
| Host Species | Mouse |
| Immunogen | DKFZp434B1231 (NP_840059, 720 a.a. ∽ 818 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?