EEA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-91859

Product Code. 18021357

Description

EEA1 Polyclonal specifically detects EEA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EEA1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: early endosome antigen 1, early endosome antigen 1, 162kD, early endosome-associated protein, Endosome-associated protein p162, MSTP105, ZFYVE2, ZFYVE2MST105, Zinc finger FYVE domain-containing protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: EEA1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERC
• Quantity: 0.1 mL
• Research Discipline: Endosome Markers, Membrane Trafficking and Chaperones
• Gene ID (Entrez): 8411
• Target Species: Human
• Isotype: IgG

For Research Use Only