EDR1/PHC1 Antibody, Novus Biologicals™

Código de producto.	Quantity	unitSize
18416120	25 μL	25µL
18223027	0.1 mL	0.1mL

Código de producto. 18416120 Proveedor Novus Biologicals N.º de proveedor NBP18400925ul

Descripción

Rabbit Polyclonal Antibody

EDR1/PHC1 Polyclonal specifically detects EDR1/PHC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Especificaciones

• Antigen: EDR1/PHC1
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: early development regulator 1 (homolog of polyhomeotic 1), Early development regulatory protein 1, EDR1, hPH1, PH1, polyhomeotic homolog 1 (Drosophila), polyhomeotic-like 1, polyhomeotic-like 1 (Drosophila), polyhomeotic-like protein 1, RAE28
• Gene Symbols: PHC1
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAVRNQQASAQGPQMQGS
• Purification Method: Affinity Purified
• Quantity: 25 μL
• Regulatory Status: RUO
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Primary or Secondary: Primary
• Gene ID (Entrez): 1911
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only