EDEM3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18414721	Novus Biologicals NBP1-88342-25ul	25 μL
18280548	Novus Biologicals NBP1-88342	0.1 mL

Description

EDEM3 Polyclonal specifically detects EDEM3 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EDEM3
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse
• Gene Alias: C1orf22, chromosome 1 open reading frame 22, ER degradation enhancer, mannosidase alpha-like 3, ER degradation-enhancing alpha-mannosidase-like 3, ER degradation-enhancing -mannosidase-like protein 3
• Gene Symbols: EDEM3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Lipid and Metabolism
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 80267
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YLYLLFADKEDIIFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only