missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EDAR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-69709
This item is not returnable.
View return policy
Description
EDAR Polyclonal specifically detects EDAR in Human samples. It is validated for Western Blot.
Specifications
| EDAR | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Anhidrotic ectodysplasin receptor 1, DLED3, Ectodermal dysplasia receptor, ectodysplasin 1, anhidrotic receptor, ectodysplasin A receptor, Ectodysplasin-A receptor, ED1R, ED5, EDA1R, EDA3EDA-A1 receptor, EDA-A1R, Edar, FLJ94390, HRM1, mouse, homolog of, tumor necrosis factor receptor superfamily member EDAR | |
| Rabbit | |
| 44 kDa | |
| 100 μL | |
| Apoptosis | |
| 10913 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9UNE0 | |
| EDAR | |
| Synthetic peptides corresponding to EDAR(ectodysplasin A receptor) The peptide sequence was selected from the middle region of EDAR. Peptide sequence PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction