EDAR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69709

Product Code. 18292453

Description

EDAR Polyclonal specifically detects EDAR in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EDAR
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Anhidrotic ectodysplasin receptor 1, DLED3, Ectodermal dysplasia receptor, ectodysplasin 1, anhidrotic receptor, ectodysplasin A receptor, Ectodysplasin-A receptor, ED1R, ED5, EDA1R, EDA3EDA-A1 receptor, EDA-A1R, Edar, FLJ94390, HRM1, mouse, homolog of, tumor necrosis factor receptor superfamily member EDAR
• Host Species: Rabbit
• Molecular Weight of Antigen: 44 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 10913
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UNE0
• Gene Symbols: EDAR
• Immunogen: Synthetic peptides corresponding to EDAR(ectodysplasin A receptor) The peptide sequence was selected from the middle region of EDAR. Peptide sequence PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only