EBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-85699

Product Code. 18221297

Description

EBP Polyclonal specifically detects EBP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EBP
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
• Gene Alias: 3-beta-hydroxysteroid-Delta(8), CDPX2, Cholestenol Delta-isomerase, CPX3-beta-hydroxysteroid-delta-8, CPXDX-linked dominant (Happle syndrome), D8-D7 sterol isomerase, Delta(7)-isomerase, Delta(8)-Delta(7) sterol isomerase, delta-7-isomerase, EC 5.3.3.5, emopamil binding protein (sterol isomerase), Emopamil-binding protein, sterol 8-isomerase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10682
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: EBP
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only