missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18409479

Ebf4 Antibody (4E10), Novus Biologicals™

Codice prodotto. 18409479 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantity:
0.1 mg
Dimensione della confezione:
0.10mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantity unitSize
18409479 0.1 mg 0.10mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18409479 Fornitore Novus Biologicals N. del fornitore H00057593M04

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Mouse Monoclonal Antibody

Ebf4 Monoclonal antibody specifically detects Ebf4 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifica

Antigen Ebf4
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 4E10
Conjugate Unconjugated
Dilution Western Blot, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH54347.1
Gene Alias early B-cell factor 4, EBF-4, olf-1/EBF-like 4, transcription factor COE4
Host Species Mouse
Immunogen EBF4 (AAH54347.1, 1 a.a. ∽ 88 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 57593
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.