missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ebf4 Antibody (4E10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00057593-M04
This item is not returnable.
View return policy
Description
Ebf4 Monoclonal antibody specifically detects Ebf4 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
Specifications
| Ebf4 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| early B-cell factor 4, EBF-4, olf-1/EBF-like 4, transcription factor COE4 | |
| EBF4 (AAH54347.1, 1 a.a. ∽ 88 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS | |
| 0.1 mg | |
| Neuroscience | |
| 57593 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA, Sandwich ELISA | |
| 4E10 | |
| Western Blot, ELISA, Sandwich ELISA | |
| AAH54347.1 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction