missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descrizione
EBAG9/RCAS1 Polyclonal specifically detects EBAG9/RCAS1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
Specifica
| Antigen | EBAG9/RCAS1 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Cancer-associated surface antigen RCAS1, EB9cancer associated surface antigen, estrogen receptor binding site associated, antigen, 9, Estrogen receptor-binding fragment-associated gene 9 protein, RCAS1PDAF, receptor-binding cancer antigen expressed on SiSo cells |
| Gene Symbols | EBAG9 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKL |
| Vedi altri risultati |
For Research Use Only
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?