missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18342751

Eaf6 Antibody, Novus Biologicals™

Product Code. 18342751 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18342751 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18342751 Supplier Novus Biologicals Supplier No. NBP191523

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Eaf6 Polyclonal specifically detects Eaf6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Eaf6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_073593
Gene Alias CENP-28, centromere protein 28, chromatin modification-related protein MEAF6, MYST/Esa1-associated factor 6, NY-SAR-91, sarcoma antigen NY-SAR-91
Gene Symbols MEAF6
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human FLJ11730. Peptide sequence HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64769
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Western clawed frog: 100%; Chicken: 100%; Xenopus: 100%; Green puffer: 100%; Zebra finch: 100%; Mouse: 100%; Human: 100%; Rat: 100%; Zebrafish: 92%; Atlantic salmon: 92%; Rainbow smelt: 85%; Filarial nematode worm: 81%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.