missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EAF1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92383-0.02ml
This item is not returnable.
View return policy
Description
EAF1 Polyclonal antibody specifically detects EAF1 in Human, Rat samples. It is validated for Western Blot
Specifications
| EAF1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| ELL (eleven nineteen lysine-rich leukemia gene)-associated factor 1, ELL associated factor 1, ELL-associated factor 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human EAF1 (NP_149074.3). LQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQ | |
| 0.02 mL | |
| DNA replication Transcription Translation and Splicing | |
| 85403 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction