missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EAAT2/GLT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17032-100UL
This item is not returnable.
View return policy
Description
EAAT2/GLT1 Polyclonal antibody specifically detects EAAT2/GLT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| EAAT2/GLT1 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| GLT1, member 2, solute carrier family 1 (glial high affinity glutamate transporter), member 2, Solute carrier family 1 member 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK | |
| 100 μg | |
| Hypoxia, Neuroscience, Neurotransmission | |
| 6506 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction