missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18336999

EAAT2/GLT1 Antibody (1D8), Novus Biologicals™

Product Code. 18336999 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18336999 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18336999 Supplier Novus Biologicals Supplier No. H00006506M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

EAAT2/GLT1 Monoclonal antibody specifically detects EAAT2/GLT1 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen EAAT2/GLT1
Applications Western Blot, ELISA
Classification Monoclonal
Clone 1D8
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004162
Gene Alias GLT1, member 2, solute carrier family 1 (glial high affinity glutamate transporter), member 2, Solute carrier family 1 member 2
Host Species Mouse
Immunogen SLC1A2 (NP_004162, 160 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Hypoxia, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 6506
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.