missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. E4F1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

E4F1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18367842 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18367842 25 μg 25µL
18361844 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18367842 Supplier Novus Biologicals Supplier No. NBP31770525UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

E4F1 Polyclonal antibody specifically detects E4F1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen E4F1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias E4F transcription factor 1p50E4F, E4FMGC99614, EC 6.3.2.-, p120E4F, Putative E3 ubiquitin-protein ligase E4F1, Transcription factor E4F, transcription factor E4F1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: VGGGHIKEVIVAAEAELGDGEMAEAPGSPHQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECK
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1877
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.