missing translation for 'onlineSavingsMsg'
Learn More
Learn More
E2F8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35168-20ul
This item is not returnable.
View return policy
Description
E2F8 Polyclonal antibody specifically detects E2F8 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| E2F8 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| E2F family member 8, E2F transcription factor 8, E2F-8, FLJ23311, transcription factor E2F8 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 788-867 of human E2F8 (NP_078956.2).,, Sequence:, PVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDVH | |
| 20 μL | |
| Cell Cycle and Replication | |
| 79733 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction