Invitrogen™ E2F4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA579182

Product Code. 15934755

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, U20S whole cell, MCF-7 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intetsinal cancer tissue.

E2F transcription factors are functionally regulated by binding to Rb p110, p107, and p130. E2F-4 is regulated by complex formation with Rb p110. E2F family members bind DNA as heterodimers with members of the DP family of polypeptides Differential phosphorylation contributes to the microheterogeniety of E2F-4 (total aa 411-416, varies due to a trinucleotide repeat).

Specifications

• Antigen: E2F4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: E2f4
• Gene Alias: 2010111M04Rik; AI427446; E2F transcription factor 4; E2F transcription factor 4, p107/p130-binding; E2F4; E2F-4; p107/p130-binding protein; transcription factor E2F4
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 100360427, 104394, 1874
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q16254, Q8R0K9
• Gene Symbols: E2f4
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human E2F4 (106-144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG