missing translation for 'onlineSavingsMsg'
Learn More
Learn More
E2F3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38580-20ul
This item is not returnable.
View return policy
Description
E2F3 Polyclonal antibody specifically detects E2F3 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| E2F3 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| DKFZp686C18211, E2F transcription factor 3, E2F-3, KIAA0075, MGC104598, transcription factor E2F3 | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human E2F3 (NP_001230005.1).,, Sequence:, SIESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQ | |
| 20 μL | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| 1871 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction