missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. E2F-1 Rabbit anti-Human, Mouse, Rat, Clone: 5Z5U3, Novus Biologicals™

E2F-1 Rabbit anti-Human, Mouse, Rat, Clone: 5Z5U3, Novus Biologicals™

Product Code. 18347014 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18347014 20 μg 20µL
18069963 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18347014 Supplier Novus Biologicals Supplier No. NBP31578520UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

E2F-1 Monoclonal antibody specifically detects E2F-1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen E2F-1
Applications Western Blot, Immunoprecipitation
Classification Monoclonal
Clone 5Z5U3
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunoprecipitation 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias E2F transcription factor 1, E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, Retinoblastoma-associated protein 1, Retinoblastoma-binding protein 3, transcription factor E2F1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 338-437 of human E2F-1 (Q01094). PPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Cycle and Replication, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 1869
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.