missing translation for 'onlineSavingsMsg'
Learn More

E2F-1 Antibody (2E10), Novus Biologicals™

Product Code. 18327657 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18327657 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18327657 Supplier Novus Biologicals Supplier No. H00001869M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

E2F-1 Monoclonal antibody specifically detects E2F-1 in Human samples. It is validated for Western Blot, ELISA, Proximity Ligation Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen E2F-1
Applications Western Blot, ELISA, Proximity Ligation Assay
Classification Monoclonal
Clone 2E10
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Proximity Ligation Assay
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005216
Gene Alias E2F transcription factor 1, E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, Retinoblastoma-associated protein 1, Retinoblastoma-binding protein 3, transcription factor E2F1
Host Species Mouse
Immunogen E2F1 (NP_005216.1, 348 a.a. ~ 437 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Cycle and Replication, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 1869
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.