missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dystrophin Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£171.00 - £401.00
Specifications
| Antigen | Dystrophin |
|---|---|
| Dilution | ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227693
|
Novus Biologicals
NBP3-33533-20ul |
20 μL |
£171.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227860
|
Novus Biologicals
NBP3-33533-100ul |
100 μL |
£401.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Dystrophin Monoclonal antibody specifically detects Dystrophin in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceSpecifications
| Dystrophin | |
| ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 1756 | |
| IgG | |
| Affinity purified |
| ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| BMDDXS272, CMD3B, DXS142, DXS164, DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, dystrophin, dystrophin (muscular dystrophy, Duchenne and Becker types), includes DXS142 | |
| A synthetic peptide corresponding to a sequence within amino acids 3586-3685 of human Dystrophin (P11532).,, Sequence:, LESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGRNTPGKPMREDTM | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title