missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18403112

Dysbindin Antibody, Novus Biologicals™

Product Code. 18403112 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18403112 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18403112 Supplier Novus Biologicals Supplier No. NBP185300

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Dysbindin Polyclonal antibody specifically detects Dysbindin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Dysbindin
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 to 1:500, Immunocytochemistry/ Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:200 to 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias DKFZp564K192, dysbindin, Dysbindin-1, dystrobrevin binding protein 1, Dystrobrevin-binding protein 1, FLJ30031, Hermansky-Pudlak syndrome 7 protein, HPS7 protein, HPS7DBND, MGC20210, My031, SDY
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKK
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 84062
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.